Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0576700_circ_g.5 |
| ID in PlantcircBase | osa_circ_020517 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 21087438-21088235 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0576700 |
| Parent gene annotation |
Similar to 60S ribosomal protein L13 (BBC1 protein homolog). (Os 03t0576700-01) |
| Parent gene strand | - |
| Alternative splicing | Os03g0576700_circ_g.2 Os03g0576700_circ_g.3 Os03g0576700_circ_g.4 Os03g0576700_circ_g.6 Os03g0576700_circ_g.7 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0576700-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | zma_circ_009051* zma_circ_002315 zma_circ_001424 |
| PMCS | 0.299418118 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
21088215-21087450(-) |
| Potential amino acid sequence |
MVKHNNVIPNGHFKKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTSGPLRPIVQCQTLK YNMKSRAGRGFTLEELKVRRRGGENGEAQQRYPQWPLQEALAELCQDMVQPARPQAEAPHCSPE EGCEDLPPPNIWPSSTHCSVPNFEVQHEVEGWERLYP*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |