Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0492100_circ_g.2 |
| ID in PlantcircBase | osa_circ_024351 |
| Alias | Os_ciR9419 |
| Organism | Oryza sativa |
| Position | chr4: 24585318-24586666 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os04g0492100 |
| Parent gene annotation |
Similar to H0425E08.1 protein. (Os04t0492100-01) |
| Parent gene strand | + |
| Alternative splicing | Os04g0492100_circ_igg.1 EPlOSAG00000040437_circ_ig.1 Os04g0492100_circ_g.1 Os04g0492100_circ_g.3 Os04g0492100_circ_g.4 Os04g0492100_circ_g.5 Os04g0492100_circ_g.6 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os04t0492100-01:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.285754077 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
24585361-24585318(+) 24585401-24586574(-) |
| Potential amino acid sequence |
MSAAACGHPFCSACWRGYISTSINDGPGCLMLRCPDPSCTAAVGQDMINSLADDEDREKYGRYL RRSYIEDNRKTKWCPAPGCEYAVEFVMGSGSYDVNCNCSYGFCWNCTEEAHRPVDCATVSKWIL KNSAESENMNWILANSKPCPKCKRPIEKNQGCMHITCTPPCKFEFCC*(+) MHYRTDGHMQQHSLTYEDNFRNKFHMSTAKLKFAWRCACNVHASLVFFNGPLALRTRL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |