Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0492100_circ_g.2 |
ID in PlantcircBase | osa_circ_024351 |
Alias | Os_ciR9419 |
Organism | Oryza sativa |
Position | chr4: 24585318-24586666 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Os04g0492100 |
Parent gene annotation |
Similar to H0425E08.1 protein. (Os04t0492100-01) |
Parent gene strand | + |
Alternative splicing | Os04g0492100_circ_igg.1 EPlOSAG00000040437_circ_ig.1 Os04g0492100_circ_g.1 Os04g0492100_circ_g.3 Os04g0492100_circ_g.4 Os04g0492100_circ_g.5 Os04g0492100_circ_g.6 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os04t0492100-01:5 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.285754077 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
24585361-24585318(+) 24585401-24586574(-) |
Potential amino acid sequence |
MSAAACGHPFCSACWRGYISTSINDGPGCLMLRCPDPSCTAAVGQDMINSLADDEDREKYGRYL RRSYIEDNRKTKWCPAPGCEYAVEFVMGSGSYDVNCNCSYGFCWNCTEEAHRPVDCATVSKWIL KNSAESENMNWILANSKPCPKCKRPIEKNQGCMHITCTPPCKFEFCC*(+) MHYRTDGHMQQHSLTYEDNFRNKFHMSTAKLKFAWRCACNVHASLVFFNGPLALRTRL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |