Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os10g0105400_circ_g.7 |
ID in PlantcircBase | osa_circ_006101 |
Alias | NA |
Organism | Oryza sativa |
Position | chr10: 409923-410886 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os10g0105400 |
Parent gene annotation |
Hypothetical conserved gene. (Os10t0105400-01);Conserved hypothe tical protein. (Os10t0105400-02);Conserved hypothetical protein. (Os10t0105400-04) |
Parent gene strand | - |
Alternative splicing | Os10g0105400_circ_g.4 Os10g0105400_circ_g.5 Os10g0105400_circ_g.6 Os10g0105400_circ_g.8 Os10g0105400_circ_g.9 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os10t0105400-02:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_008777 |
PMCS | 0.174008705 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
410843-410263(+) 410400-410838(-) |
Potential amino acid sequence |
MTFLRQSLQNLLLSNLFFEYHCSSIQKKLSGKFRTLSMLLWMNTIDISIISIPVHSIIFILFLS FFSMLKETLNAFSLSNCHKPIPHDQPAVNT*(+) MNGQVHRKGLDLDQFEDYFVTLRAHYADNKNTDFYVKAHALKGQSCVHRRLIVGDGFVTITKGE SIQSFFEHAEEAEEEDEDDAMDRDGNDTDVDGVHPQKHAKSPELAREFLLDAAAVIFKEQVRQQ KILQRLPKECHS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |