Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0105400_circ_g.7 |
| ID in PlantcircBase | osa_circ_006101 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr10: 409923-410886 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os10g0105400 |
| Parent gene annotation |
Hypothetical conserved gene. (Os10t0105400-01);Conserved hypothe tical protein. (Os10t0105400-02);Conserved hypothetical protein. (Os10t0105400-04) |
| Parent gene strand | - |
| Alternative splicing | Os10g0105400_circ_g.4 Os10g0105400_circ_g.5 Os10g0105400_circ_g.6 Os10g0105400_circ_g.8 Os10g0105400_circ_g.9 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os10t0105400-02:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_008777 |
| PMCS | 0.174008705 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
410843-410263(+) 410400-410838(-) |
| Potential amino acid sequence |
MTFLRQSLQNLLLSNLFFEYHCSSIQKKLSGKFRTLSMLLWMNTIDISIISIPVHSIIFILFLS FFSMLKETLNAFSLSNCHKPIPHDQPAVNT*(+) MNGQVHRKGLDLDQFEDYFVTLRAHYADNKNTDFYVKAHALKGQSCVHRRLIVGDGFVTITKGE SIQSFFEHAEEAEEEDEDDAMDRDGNDTDVDGVHPQKHAKSPELAREFLLDAAAVIFKEQVRQQ KILQRLPKECHS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |