Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT2G43970_circ_g.14 |
ID in PlantcircBase | ath_circ_018257 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr2: 18206274-18206480 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT2G43970 |
Parent gene annotation |
La-related protein 6B |
Parent gene strand | - |
Alternative splicing | AT2G43970_circ_g.12 AT2G43970_circ_g.13 AT2G43970_circ_g.15 |
Support reads | 1 |
Tissues | whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT2G43970.2:1 AT2G43970.1:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.121174716 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
18206289-18206276(-) |
Potential amino acid sequence |
MLKHQVHAFVEYEIVELAERAVTELSEAGNWRSGLKVRLMLKHQVHAFVEYEIVELAERAVTEL SEAGNWRSGLKVRLMLKHQVHAFVEYEIVELAERAVTELSEAGNWRSGLKVRLMLKHQ(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |