Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT2G43970_circ_g.12 |
| ID in PlantcircBase | ath_circ_018255 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr2: 18205936-18206342 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT2G43970 |
| Parent gene annotation |
La-related protein 6B |
| Parent gene strand | - |
| Alternative splicing | AT2G43970_circ_g.13 AT2G43970_circ_g.14 AT2G43970_circ_g.15 |
| Support reads | 10 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT2G43970.1:2 AT2G43970.2:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.138615213 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
18206289-18205938(-) |
| Potential amino acid sequence |
MLKHQTKEPKQGQGRGRKGHDADVEHEEDDATTSEQQPIEKQSDDCSGEWDTHMQEQPIVTELS EAGNWRSGLKVRLMLKHQTKEPKQGQGRGRKGHDADVEHEEDDATTSEQQPIEKQSDDCSGEWD THMQEQPIVTELSEAGNWRSGLKVRLMLKHQTKEPKQGQGRGRKGHDADVEHEEDDATTSEQQP IEKQSDDCSGEWDTHMQEQPIVTELSEAGNWRSGLKVRLMLKHQTKEPKQGQGRGRKGHDADVE HEEDDATTSEQQPIEKQSDDCSGEWDTHMQEQPI(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |