Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Solyc06g005080.2_circ_g.8 |
| ID in PlantcircBase | sly_circ_001852 |
| Alias | 6:80044|80638, Slcirc097 |
| Organism | Solanum lycopersicum |
| Position | chr6: 80044-80638 JBrowse» |
| Reference genome | SL2.50.38 |
| Type | e-circRNA |
| Identification method | CIRI, circseq_cup |
| Parent gene | Solyc06g005080.2 |
| Parent gene annotation |
protein_coding |
| Parent gene strand | - |
| Alternative splicing | Solyc06g005080.2_circ_g.3 Solyc06g005080.2_circ_g.4 Solyc06g005080.2_circ_g.5 Solyc06g005080.2_circ_g.6 Solyc06g005080.2_circ_g.7 |
| Support reads | 23/10 |
| Tissues | fruit/leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Solyc06g005080.2.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.83802968 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
80512-80044(+) 80514-80046(-) |
| Potential amino acid sequence |
MVVASSNTSLQSLRKARNSLMSDWYSVLLLSKASSSSRSSRLI*(+) MKLLESYGRVDELVFFASLKEQYEIVLHHYIQINRLLLEDDDALDSNNTEYQSLIKEFRAFLSD CKDVLDEATTMKLLESYGRVDELVFFASLKEQYEIVLHHYIQINRLLLEDDDALDSNNTEYQSL IKEFRAFLSDCKDVLDEATTMKLLESYGRVDELVFFASLKEQYEIVLHHYIQINRLLLEDDDAL DSNNTEYQSLIKEFRAFLSDCKDVLDEATTMKLLESYGRVDELVFFASLKEQYEIVLHHYIQ(- ) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zuo et al., 2016; Yin et al., 2018; Wang et al., 2018b |