Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d035212_circ_g.8 |
ID in PlantcircBase | zma_circ_008891 |
Alias | Zm06circ00007, zma_circ_0002093 |
Organism | Zea mays |
Position | chr6: 10039525-10039731 JBrowse» |
Reference genome | AGPv4.38 |
Type | e-circRNA |
Identification method | CIRI2, find_circ |
Parent gene | Zm00001d035212 |
Parent gene annotation |
Chloroplast stem-loop binding protein of 41 kDa b chloroplastic |
Parent gene strand | + |
Alternative splicing | Zm00001d035212_circ_g.1 Zm00001d035212_circ_g.2 Zm00001d035212_circ_g.3 Zm00001d035212_circ_g.4 Zm00001d035212_circ_g.5 Zm00001d035212_circ_g.6 Zm00001d035212_circ_g.7 |
Support reads | NA |
Tissues | leaf, endosperm, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d035212_T001:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.271808224 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
10039605-10039728(+) 10039591-10039676(-) |
Potential amino acid sequence |
MSPSTALRGHAQRLEGSLSRSSSTTTPRNSTSERRRPSHSETRIWQEPSTWCSGTPRRASRSST SPGPSMSPSTALRGHAQRLEGSLSRSSSTTTPRNSTSERRRPSHSETRIWQEPSTWCSGTPRRA SRSSTSPGPSMSPSTALRGHAQRLEGSLSRSSSTTTPRNSTSERRRPSHSETRIWQEPSTWCSG TPRRASRSSTSPGPSMSPSTALRGHAQRLEGSLSRSSSTTTPRNSTSERRRPSHSET(+) MLKICLLALGFPSTRLKALARSWSLNGKAFFFPKSNSLGL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Han et al., 2020; Ma et al., 2021b |