Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | BGIOSGA018086_circ_g.5 |
ID in PlantcircBase | osi_circ_006232 |
Alias | 5:20850305|20851291 |
Organism | Oryza sativa ssp. indica |
Position | chr5: 20850305-20851291 JBrowse» |
Reference genome | Oryza_indica.ASM465v1.42 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | BGIOSGA018086 |
Parent gene annotation | NA |
Parent gene strand | - |
Alternative splicing | BGIOSGA018086_circ_g.3 BGIOSGA018086_circ_g.4 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | BGIOSGA018086-TA:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
20851199-20851285(-) 20851251-20850343(+) |
Potential amino acid sequence |
MLLLAGSAIVNEAILTGESTPQWKVSVAGRGPEETLSVKRDKNHILFGGTKILQHTPDKMG*(- ) MSPGSSSVPGILTHLIWSMLQYLSATK*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Huang et al., 2021 |