Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G04870_circ_g.2 |
| ID in PlantcircBase | ath_circ_019738 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr3: 1343722-1343856 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, CIRI-full |
| Parent gene | AT3G04870 |
| Parent gene annotation |
Zeta-carotene desaturase, chloroplastic/chromoplastic |
| Parent gene strand | + |
| Alternative splicing | AT3G04870_circ_g.3 AT3G04870_circ_g.4 AT3G04870_circ_g.5 |
| Support reads | 7 |
| Tissues | leaf, aerial |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT3G04870.2:1 AT3G04870.3:1 AT3G04870.4:1 AT3G04870.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.317537337 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1343800-1343853(+) |
| Potential amino acid sequence |
MGLHVFFGCYNNLFRLMKKVDIYDSRTFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKK VDIYDSRTFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVDIYDSRTFIGGKVGSFVD RRGNHIEMGLHVFFGCYNNLFRLMKK(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |