Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT3G04870_circ_g.2 |
ID in PlantcircBase | ath_circ_019738 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr3: 1343722-1343856 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, CIRI-full |
Parent gene | AT3G04870 |
Parent gene annotation |
Zeta-carotene desaturase, chloroplastic/chromoplastic |
Parent gene strand | + |
Alternative splicing | AT3G04870_circ_g.3 AT3G04870_circ_g.4 AT3G04870_circ_g.5 |
Support reads | 7 |
Tissues | leaf, aerial |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT3G04870.2:1 AT3G04870.3:1 AT3G04870.4:1 AT3G04870.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.317537337 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
1343800-1343853(+) |
Potential amino acid sequence |
MGLHVFFGCYNNLFRLMKKVDIYDSRTFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKK VDIYDSRTFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVDIYDSRTFIGGKVGSFVD RRGNHIEMGLHVFFGCYNNLFRLMKK(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |