Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0156300_circ_g.1 |
| ID in PlantcircBase | osa_circ_026654 |
| Alias | Os_ciR10189 |
| Organism | Oryza sativa |
| Position | chr5: 3295247-3295349 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os05g0156300 |
| Parent gene annotation |
Similar to protein disulfide isomerase. (Os05t0156300-01);Simila r to Protein disulfide isomerase. (Os05t0156300-02);Similar to P rotein disulfide isomerase. (Os05t0156300-03) |
| Parent gene strand | - |
| Alternative splicing | Os05g0156300_circ_g.2 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os05t0156300-02:1 Os05t0156300-01:1 Os05t0156300-03:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.293463916 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3295311-3295295(-) |
| Potential amino acid sequence |
MEKGSEYTKKESERLQRMLEKQVRKDLCELCKEDHGEGL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |