Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os05g0156300_circ_g.2 |
ID in PlantcircBase | osa_circ_026655 |
Alias | NA |
Organism | Oryza sativa |
Position | chr5: 3295247-3295796 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os05g0156300 |
Parent gene annotation |
Similar to protein disulfide isomerase. (Os05t0156300-01);Simila r to Protein disulfide isomerase. (Os05t0156300-02);Similar to P rotein disulfide isomerase. (Os05t0156300-03) |
Parent gene strand | - |
Alternative splicing | Os05g0156300_circ_g.1 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os05t0156300-03:3 Os05t0156300-02:3 Os05t0156300-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_015910 |
PMCS | 0.233602742 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
3295475-3295739(-) |
Potential amino acid sequence |
MEEDVAKLTGPAAKYGKIYVNSAKKIMEKGSEYTKKESERLQRMLEKVWSFWFPHIEILPKGKQ SW*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |