Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d010546_circ_g.3 |
ID in PlantcircBase | zma_circ_009673 |
Alias | Zm08circ00046, zma_circ_0002759, GRMZM2G390400_C2 |
Organism | Zea mays |
Position | chr8: 120075635-120076679 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | CIRI2, find_circ |
Parent gene | Zm00001d010546 |
Parent gene annotation |
Putative SAC3/GANP family protein |
Parent gene strand | - |
Alternative splicing | Zm00001d010546_circ_g.1 Zm00001d010546_circ_g.2 |
Support reads | NA |
Tissues | leaf, endosperm, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d010546_T022:3 Zm00001d010546_T005:3 Zm00001d010546_T015:3 Zm00001d010546_T023:3 Zm00001d010546_T019:3 Zm00001d010546_T008:3 Zm00001d010546_T006:3 Zm00001d010546_T001:3 Zm00001d010546_T016:3 Zm00001d010546_T004:3 Zm00001d010546_T012:3 Zm00001d010546_T021:3 Zm00001d010546_T002:3 Zm00001d010546_T003:3 Zm00001d010546_T018:3 Zm00001d010546_T025:3 Zm00001d010546_T007:3 Zm00001d010546_T013:3 Zm00001d010546_T017:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.238530366 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
120076283-120076676(-) |
Potential amino acid sequence |
MASNLSQIQNGSASSDSEKEHDLTKHYASATALANSPEEKKRREHRSKRFEKSKDSSLKSRNAS ANNDGMASFRARRAISSLRTRTYEEGTLAVEDMDWDALTVKGTCQEIEKRYLRLTEAPDPAKVR PEDVLEKALAMVETSEKNYLYKCDQLKSIRQDLTVQRIQNELTVKQ*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Han et al., 2020; Ma et al., 2021b;Zhang et al., 2019 |