Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0702600_circ_g.5 |
| ID in PlantcircBase | osa_circ_016133 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 28957396-28957511 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0702600 |
| Parent gene annotation |
Rop nucleotide exchanger, PRONE domain containing protein. (Os02 t0702600-01);Rop nucleotide exchanger, PRONE domain containing p rotein. (Os02t0702600-02);Similar to predicted protein. (Os02t07 02600-03) |
| Parent gene strand | - |
| Alternative splicing | Os02g0702600_circ_g.2 Os02g0702600_circ_g.3 Os02g0702600_circ_g.4 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0702600-02:1 Os02t0702600-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.350462428 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
28957512-28957499(+) 28957473-28957470(-) |
| Potential amino acid sequence |
MSGSWSMSMLKSCGRRRQHASVFILIPLLGSRYRQ*(+) MRMKTLACCRRRPQDFSIDMDQEPDITAATAGTGCRGGE*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |