Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os11g0524300_circ_g.3 |
ID in PlantcircBase | osa_circ_009452 |
Alias | NA |
Organism | Oryza sativa |
Position | chr11: 18983749-18985522 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os11g0524300 |
Parent gene annotation |
Protein of unknown function DUF1001 family protein. (Os11t052430 0-01) |
Parent gene strand | + |
Alternative splicing | Os11g0524300_circ_g.1 Os11g0524300_circ_g.2 Os11g0524300_circ_g.4 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os11t0524051-00:2 Os11t0524051-00:2 Os11t0524300-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.116403824 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
18983751-18983787(+) 18985441-18983787(+) |
Potential amino acid sequence |
MLTCPATEMVDGSRVLYFEQAFWRSPEKPFRQRFYMVKPCPKDMKCDVELSSYAIRDVEEYKNF CDRPKDQRPQPEEVIADAYMPCNRDGGWF*(+) MQLEMLKSTRISVTVQRIRGHNQKKSLRMLTCPATEMVDGSRVLYFEQAFWRSPEKPFRQRFYM VKPCPKDMKCDVELSSYAIRDVEEYKNFCDRPKDQRPQPEEVIADAYMPCNRDGGWF*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |