Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os11g0524300_circ_g.3 |
| ID in PlantcircBase | osa_circ_009452 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr11: 18983749-18985522 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os11g0524300 |
| Parent gene annotation |
Protein of unknown function DUF1001 family protein. (Os11t052430 0-01) |
| Parent gene strand | + |
| Alternative splicing | Os11g0524300_circ_g.1 Os11g0524300_circ_g.2 Os11g0524300_circ_g.4 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os11t0524051-00:2 Os11t0524051-00:2 Os11t0524300-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.116403824 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
18983751-18983787(+) 18985441-18983787(+) |
| Potential amino acid sequence |
MLTCPATEMVDGSRVLYFEQAFWRSPEKPFRQRFYMVKPCPKDMKCDVELSSYAIRDVEEYKNF CDRPKDQRPQPEEVIADAYMPCNRDGGWF*(+) MQLEMLKSTRISVTVQRIRGHNQKKSLRMLTCPATEMVDGSRVLYFEQAFWRSPEKPFRQRFYM VKPCPKDMKCDVELSSYAIRDVEEYKNFCDRPKDQRPQPEEVIADAYMPCNRDGGWF*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |