Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | BGIOSGA018078_circ_g.1 |
ID in PlantcircBase | osi_circ_006233 |
Alias | 5:20966920|20967790 |
Organism | Oryza sativa ssp. indica |
Position | chr5: 20966920-20967790 JBrowse» |
Reference genome | Oryza_indica.ASM465v1.42 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | BGIOSGA018078 |
Parent gene annotation | NA |
Parent gene strand | - |
Alternative splicing | BGIOSGA018078_circ_g.2 BGIOSGA018078_circ_g.3 BGIOSGA018078_circ_g.4 BGIOSGA018078_circ_g.5 BGIOSGA018078_circ_g.6 BGIOSGA018078_circ_g.7 BGIOSGA018078_circ_g.8 BGIOSGA018078_circ_g.9 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | BGIOSGA018078-TA:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
20967721-20967781(-) 20967730-20966971(+) |
Potential amino acid sequence |
MVRELCSETGAAQDDVLARVEKLSEVNPMLGFRGCRLGISYPELTEMQARAIFEAAITMTNQGI QVFPEIMVPLVGTPQELGHQVDVIRQIANKVFTDMGKTIGYKVGTMIEIPRAALVADEGFR*(- ) MAFWKELMKWRIQESNSYRKPSSATKAALGISIIVPTL*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Huang et al., 2021 |