Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d048529_circ_g.1 |
| ID in PlantcircBase | zma_circ_010116 |
| Alias | Zm09circ00080, ZmciR381 |
| Organism | Zea mays |
| Position | chr9: 157916927-157918704 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | e-circRNA |
| Identification method | CIRI2 |
| Parent gene | Zm00001d048529 |
| Parent gene annotation |
Developmentally-regulated GTP-binding protein 2 |
| Parent gene strand | - |
| Alternative splicing | Zm00001d048529_circ_g.2 |
| Support reads | NA |
| Tissues | leaf, endosperm |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Zm00001d048529_T001:3 Zm00001d048529_T002:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.165564412 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
157918698-157917166(+) 157916939-157918382(-) 157917245-157918686(-) |
| Potential amino acid sequence |
MIFFEASRTISTRSDDFATAITCLPRPLPSEAPSMIPGRSRSWILVSL*(+) MPQRISSWTTEGKTSKVEDTTIRASKGFQRRWRWF*(-) MLTGTHSEAASYEFTTLTCIPGIVHYNDTKIQLLDLPGIIEGASEGKGRGRQVIAVAKSSDLVL MVLDASKNIILDN*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Han et al., 2020;Zhang et al., 2019 |