Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | BGIOSGA001202_circ_g.4 |
ID in PlantcircBase | osi_circ_002213 |
Alias | 1:27584109|27584560 |
Organism | Oryza sativa ssp. indica |
Position | chr1: 27584109-27584560 JBrowse» |
Reference genome | Oryza_indica.ASM465v1.42 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | BGIOSGA001202 |
Parent gene annotation | NA |
Parent gene strand | - |
Alternative splicing | BGIOSGA001202_circ_igg.1 BGIOSGA001202_circ_igg.2 BGIOSGA001202_circ_g.1 BGIOSGA001202_circ_g.2 BGIOSGA001202_circ_g.3 BGIOSGA001202_circ_g.5 BGIOSGA001202_circ_g.6 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | BGIOSGA001202-TA:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
27584468-27584557(-) 27584441-27584330(+) |
Potential amino acid sequence |
MTEDQFDFHSYCLRKMTLRAYVSMLKFQDRLHAHEYFHKAAAGAIRCYMKLHDSPSKSSTEEND EMSKLPPAQRKKLRQKQKKAEARAKRV*(-) MEVKLIFSHVSIMLLNSQEIFESPAEITLTIVTLTRSKLIPFWHELLPFSVFVSVSSSEQVAIS TFHHSPQWMILMVNHAISYNT*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Huang et al., 2021 |