Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os05g0241150_circ_g.6 |
ID in PlantcircBase | osa_circ_027141 |
Alias | NA |
Organism | Oryza sativa |
Position | chr5: 8605768-8606054 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os05g0241150 |
Parent gene annotation |
Hypothetical protein. (Os05t0241150-00) |
Parent gene strand | - |
Alternative splicing | Os05g0241150_circ_g.3 Os05g0241150_circ_g.4 Os05g0241150_circ_g.5 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os05t0241200-02:2 Os05t0241200-01:2 Os05t0241200-02:2 Os05t0241150-00:2 Os05t0241200-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_015198 |
PMCS | 0.254275697 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
8605777-8605827(+) 8605830-8606052(-) |
Potential amino acid sequence |
MASLTELSFNWTGFVNAMISNISFTLRSVYSKKAMTDMDSTNLYAYISIIALLVCIPPAIIVFQ WHLSLNFHSIGLVSLMP*(+) MALTKPVQLNESSVRDAIETQ*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |