Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.005G196700_circ_g.1 |
| ID in PlantcircBase | gra_circ_000516 |
| Alias | Chr05:57032789|57033133 |
| Organism | Gossypium raimondii |
| Position | chrChr05: 57032789-57033133 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | ue-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.005G196700 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | orai.005G196700_circ_g.2 orai.005G196700_circ_g.3 |
| Support reads | 7 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.005G196700.5:1 Gorai.005G196700.2:2 Gorai.005G196700.4:2 Gorai.005G196700.1:2 Gorai.005G196700.3:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.677355048 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
57032849-57032989(-) |
| Potential amino acid sequence |
MGKPCHSDSISVKEKFIHAKVRSLTLDVKVWDPSVISLFQSLGNTFANSVWEELLHSRNAFHVD LTPR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |