Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0344700_circ_g.7 |
| ID in PlantcircBase | osa_circ_019753 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 12842527-12842848 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0344700 |
| Parent gene annotation |
Similar to AAA-type ATPase family protein. (Os03t0344700-01) |
| Parent gene strand | - |
| Alternative splicing | Os03g0344700_circ_igg.1 Os03g0344700_circ_g.2 Os03g0344700_circ_g.3 Os03g0344700_circ_g.4 Os03g0344700_circ_g.5 Os03g0344700_circ_igg.6 Os03g0344700_circ_igg.8 Os03g0344700_circ_g.9 Os03g0344700_circ_g.10 Os03g0344700_circ_g.11 Os03g0344700_circ_g.12 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0344700-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.226539648 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
12842786-12842564(+) 12842626-12842847(-) |
| Potential amino acid sequence |
MTSNGCFDLISHPGASRHKESTSLCDHQDVHENQ*(+) MIPIVLSRASFNISQQVLLLLVLMYILMITKRS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |