Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0925000_circ_g.5 |
| ID in PlantcircBase | osa_circ_005598 |
| Alias | Os_ciR1599 |
| Organism | Oryza sativa |
| Position | chr1: 40552701-40553612 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder, circRNA_finder, find_circ |
| Parent gene | Os01g0925000 |
| Parent gene annotation |
ENTH/VHS domain containing protein. (Os01t0925000-01);ENTH/VHS d omain containing protein. (Os01t0925000-02) |
| Parent gene strand | - |
| Alternative splicing | Os01g0925000_circ_g.2 Os01g0925000_circ_g.3 Os01g0925000_circ_g.4 |
| Support reads | 8/4 |
| Tissues | root/shoot, root, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0925000-01:2 Os01t0925000-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_002648* osi_circ_011137 |
| PMCS | 0.501550014 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
40553557-40552754(+) 40553559-40553570(-) 40552752-40553570(-) |
| Potential amino acid sequence |
MLCNLAWALRIPQIPEVRNQSLYDIPSKIIAVDKHIV*(+) MNAGFSPQILAQKLLKLNNSRQSIETLSHWCVFHYRHCRQVVETWESDFHSAPRERRVSLLYLA NDIVQNSKKDSGRYVNEFWRVIPAALNDVFVNGDDFGRNVVQRLVSYLWNLGDSQRPS*(-) MCLSTAMILEGMSYRDWFLTSGIWGILNAQARLHNMNAGFSPQILAQKLLKLNNSRQSIETLSH WCVFHYRHCRQVVETWESDFHSAPRERRVSLLYLANDIVQNSKKDSGRYVNEFWRVIPAALNDV FVNGDDFGRNVVQRLVSYLWNLGDSQRPS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |