Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0925000_circ_g.5 |
ID in PlantcircBase | osa_circ_005598 |
Alias | Os_ciR1599 |
Organism | Oryza sativa |
Position | chr1: 40552701-40553612 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder, circRNA_finder, find_circ |
Parent gene | Os01g0925000 |
Parent gene annotation |
ENTH/VHS domain containing protein. (Os01t0925000-01);ENTH/VHS d omain containing protein. (Os01t0925000-02) |
Parent gene strand | - |
Alternative splicing | Os01g0925000_circ_g.2 Os01g0925000_circ_g.3 Os01g0925000_circ_g.4 |
Support reads | 8/4 |
Tissues | root/shoot, root, seed |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os01t0925000-01:2 Os01t0925000-02:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_002648* osi_circ_011137 |
PMCS | 0.501550014 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
40553557-40552754(+) 40553559-40553570(-) 40552752-40553570(-) |
Potential amino acid sequence |
MLCNLAWALRIPQIPEVRNQSLYDIPSKIIAVDKHIV*(+) MNAGFSPQILAQKLLKLNNSRQSIETLSHWCVFHYRHCRQVVETWESDFHSAPRERRVSLLYLA NDIVQNSKKDSGRYVNEFWRVIPAALNDVFVNGDDFGRNVVQRLVSYLWNLGDSQRPS*(-) MCLSTAMILEGMSYRDWFLTSGIWGILNAQARLHNMNAGFSPQILAQKLLKLNNSRQSIETLSH WCVFHYRHCRQVVETWESDFHSAPRERRVSLLYLANDIVQNSKKDSGRYVNEFWRVIPAALNDV FVNGDDFGRNVVQRLVSYLWNLGDSQRPS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |