Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0405600_circ_g.3 |
| ID in PlantcircBase | osa_circ_023744 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 20127500-20129746 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os04g0405600 |
| Parent gene annotation |
Protein of unknown function DUF1350 family protein. (Os04t040560 0-01);Protein of unknown function DUF1350 family protein. (Os04t 0405600-02) |
| Parent gene strand | - |
| Alternative splicing | Os04g0405600_circ_g.1 Os04g0405600_circ_g.2 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os04t0405600-02:5 Os04t0405600-01:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.112732321 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
20129702-20127600(+) 20129722-20127578(+) 20129651-20129716(-) |
| Potential amino acid sequence |
MIKAASIWRCDHQSSPADVSLLALERILLGLLLNPYTVEEVAELMAGAA*(+) MALRSPKLPSRRVSSGFGTNSSRPFTKSIYSGGSC*(+) MVEPVNDLPTFGVGHSLGSVIHLLIGSRYAVQRSGNILMAFNNKEASLAVPLFSPVIVPMAQSF GPIFSQLTSYPTLRFGAEAAIKQLENLSPPVVKQLLPLVQQLPPLYMDLVKGREEFVPKPEETR RLGSFGDRNAIC*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |