Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0405600_circ_g.3 |
ID in PlantcircBase | osa_circ_023744 |
Alias | NA |
Organism | Oryza sativa |
Position | chr4: 20127500-20129746 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os04g0405600 |
Parent gene annotation |
Protein of unknown function DUF1350 family protein. (Os04t040560 0-01);Protein of unknown function DUF1350 family protein. (Os04t 0405600-02) |
Parent gene strand | - |
Alternative splicing | Os04g0405600_circ_g.1 Os04g0405600_circ_g.2 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os04t0405600-02:5 Os04t0405600-01:5 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.112732321 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
20129702-20127600(+) 20129722-20127578(+) 20129651-20129716(-) |
Potential amino acid sequence |
MIKAASIWRCDHQSSPADVSLLALERILLGLLLNPYTVEEVAELMAGAA*(+) MALRSPKLPSRRVSSGFGTNSSRPFTKSIYSGGSC*(+) MVEPVNDLPTFGVGHSLGSVIHLLIGSRYAVQRSGNILMAFNNKEASLAVPLFSPVIVPMAQSF GPIFSQLTSYPTLRFGAEAAIKQLENLSPPVVKQLLPLVQQLPPLYMDLVKGREEFVPKPEETR RLGSFGDRNAIC*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |