Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0778300_circ_g.4 |
ID in PlantcircBase | osa_circ_016772 |
Alias | Os_ciR8134 |
Organism | Oryza sativa |
Position | chr2: 32948236-32948965 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os02g0778300 |
Parent gene annotation |
Conserved hypothetical protein. (Os02t0778300-01);Similar to pre dicted protein. (Os02t0778300-02);Non-protein coding transcript. (Os02t0778300-03) |
Parent gene strand | + |
Alternative splicing | Os02g0778300_circ_g.1 Os02g0778300_circ_g.2 Os02g0778300_circ_g.3 Os02g0778300_circ_g.5 Os02g0778300_circ_g.6 Os02g0778300_circ_g.7 Os02g0778300_circ_g.8 Os02g0778300_circ_g.9 Os02g0778300_circ_g.10 |
Support reads | 2/2 |
Tissues | root/shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0778300-01:2 Os02t0778300-02:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.141874829 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
32948916-32948259(+) 32948318-32948291(-) |
Potential amino acid sequence |
MALLQYQRENIHYLSEEGISTSTTL*(+) MVGVGVQNIRTAKYQGAHSESCTCGYALLTQVMNILPLVLKQSHLLVRKTTIIIPSFFQRTRWL ELECRI*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |