Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0778300_circ_g.6 |
| ID in PlantcircBase | osa_circ_016774 |
| Alias | Os_ciR3785, |
| Organism | Oryza sativa |
| Position | chr2: 32948236-32949484 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ, CIRI-long |
| Parent gene | Os02g0778300 |
| Parent gene annotation |
Conserved hypothetical protein. (Os02t0778300-01);Similar to pre dicted protein. (Os02t0778300-02);Non-protein coding transcript. (Os02t0778300-03) |
| Parent gene strand | + |
| Alternative splicing | Os02g0778300_circ_g.1 Os02g0778300_circ_g.2 Os02g0778300_circ_g.3 Os02g0778300_circ_g.4 Os02g0778300_circ_g.5 Os02g0778300_circ_g.7 Os02g0778300_circ_g.8 Os02g0778300_circ_g.9 Os02g0778300_circ_g.10 |
| Support reads | 2 |
| Tissues | root, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0778300-02:4 Os02t0778300-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.119684154 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
32948916-32948259(+) 32948318-32949445(-) |
| Potential amino acid sequence |
MALLQYQRENIHYLSEEVLRLQECLSKYQRTDVGSTPQADLAHLLASRDQELRALSAEGISTST TL*(+) MVGVGVQNIRTAKYQGAHSESCTCGYALSGECSKFLITRC*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015; this study |