Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0252150_circ_g.5 |
| ID in PlantcircBase | osa_circ_001112 |
| Alias | Os_ciR2774 |
| Organism | Oryza sativa |
| Position | chr1: 8332409-8332549 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os01g0252150 |
| Parent gene annotation |
Hypothetical protein. (Os01t0252150-00) |
| Parent gene strand | - |
| Alternative splicing | Os01g0252100_circ_g.4 |
| Support reads | 4/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0252100-01:1 Os01t0252100-03:1 Os01t0252100-02:1 Os01t0252100-01:1 Os01t0252150-00:1 Os01t0252100-03:1 Os01t0252100-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.641343026 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
8332539-8332546(+) 8332439-8332452(-) |
| Potential amino acid sequence |
MLGQVKGEPNISYICSRYYRAPELIFGATEYTTAIDIWSAGCVLAELMLGQVKGEPNISYICSR YYRAPELIFGATEYTTAIDIWSAGCVLAELMLGQVKGEPNISYICSRYYRAPELIFGATEYTTA IDIWSAGCVLAELMLGQ(+) MYDMFGSPLTCPNISSARTHPADQMSIAVVYSVAPNMSSGAL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |