Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0252100_circ_g.4 |
| ID in PlantcircBase | osa_circ_001111 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 8332107-8333273 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0252100 |
| Parent gene annotation |
Similar to Glycogen synthase kinase-3 homolog MsK-3 (EC 2.7.1.-) . (Os01t0252100-01);Similar to Glycogen synthase kinase-3 homolo g MsK-3 (EC 2.7.1.-). (Os01t0252100-02);Similar to Glycogen synt hase kinase-3 homolog MsK-3 (EC 2.7.1.-). (Os01t0252100-03) |
| Parent gene strand | + |
| Alternative splicing | Os01g0252150_circ_g.5 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0252100-02:7 Os01t0252100-03:7 Os01t0252100-01:7 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.221572715 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
8332539-8332111(+) 8333200-8332111(+) |
| Potential amino acid sequence |
MLGQPLFPGESGVDQLVEIIKVLGTPTREEIKCMNPNYTEFKFPQIKAHPWHKVFHKRLPPEAV DLVSRLLQYSPNLRCTAVEALVHPFFDELRDPNARLPNGRFLPPLFNFKPHDL*(+) MSFETLMLAFRMAAFCLLSSTSSLMICRALAYIHNSIGVCHRDIKPQNLLVNPHTHQLKLCDFG SAKVLVKGEPNISYICSRYYRAPELIFGATEYTTAIDIWSAGCVLAELMLGQPLFPGESGVDQL VEIIKVLGTPTREEIKCMNPNYTEFKFPQIKAHPWHKVFHKRLPPEAVDLVSRLLQYSPNLRCT AVEALVHPFFDELRDPNARLPNGRFLPPLFNFKPHDL*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |