Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0728100_circ_g.4 |
ID in PlantcircBase | osa_circ_016381 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 30301447-30305415 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0728100 |
Parent gene annotation |
Similar to SPPA; serine-type endopeptidase. (Os02t0728100-01);Pe ptidase S49 domain containing protein. (Os02t0728100-02) |
Parent gene strand | - |
Alternative splicing | Os02g0727966_circ_ag.1 Os02g0728100_circ_g.1 Os02g0728100_circ_g.2 Os02g0728100_circ_g.3 Os02g0728100_circ_g.5 Os02g0728100_circ_g.6 Os02g0728100_circ_g.7 Os02g0728100_circ_g.8 Os02g0728100_circ_g.9 Os02g0728100_circ_g.10 |
Support reads | 3 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0728100-01:6 Os02t0728100-02:6 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.110846993 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
30305374-30302336(+) 30305122-30305347(-) |
Potential amino acid sequence |
MTARKRSVSSTDRISLTVRIFSINCSAMMPELGTLNGLRVRVMLPDALITAICSPPPCNPRVHL LTREYLL*(+) MPVCGEKEYYLACACGELYAPPSAYVALFGLTVQQTFLRGVLEKVGIEPEIQRIGRYKSAGDQL ARKSMSNEVREMLATLLDNIYGNWLDTISSKHGKKKEEIEEFINSGVYQVARLKEEGWITDLLY DDEVMAMLKERVAQKDKKSLRMVDYSKYSRVSKWTLGLQGGGEQIAVIRASGSITRTRSPLSVP SSGIIAEQLIEKIRTVRDIRSVEDTLLFRAVIATNLREFC*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |