Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0728100_circ_g.7 |
| ID in PlantcircBase | osa_circ_016383 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 30304271-30304614 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0728100 |
| Parent gene annotation |
Similar to SPPA; serine-type endopeptidase. (Os02t0728100-01);Pe ptidase S49 domain containing protein. (Os02t0728100-02) |
| Parent gene strand | - |
| Alternative splicing | Os02g0727966_circ_ag.1 Os02g0728100_circ_g.1 Os02g0728100_circ_g.2 Os02g0728100_circ_g.3 Os02g0728100_circ_g.4 Os02g0728100_circ_g.5 Os02g0728100_circ_g.6 Os02g0728100_circ_g.8 Os02g0728100_circ_g.9 Os02g0728100_circ_g.10 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0728100-01:2 Os02t0728100-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_012236 |
| PMCS | 0.327451623 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
30304530-30304593(-) |
| Potential amino acid sequence |
MSNEVREMLATLLDNIYGNWLDTISSKHGKKKEEIEEFINSGVYQVARLKEEGWITDLLYDDEV FLRKSG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |