Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os06g0153800_circ_g.3 |
ID in PlantcircBase | osa_circ_029723 |
Alias | NA |
Organism | Oryza sativa |
Position | chr6: 2772160-2772487 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os06g0153800 |
Parent gene annotation |
Beta 5 subunit of 20S proteasome. (Os06t0153800-01) |
Parent gene strand | - |
Alternative splicing | Os06g0153800_circ_g.4 |
Support reads | 1 |
Tissues | shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os06t0153800-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_006536* osi_circ_016684 |
PMCS | 0.402683308 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
2772418-2772220(+) 2772399-2772375(-) 2772362-2772476(-) |
Potential amino acid sequence |
MLAKSFEAPAIEILRLFASSWSRHPRPRYHRHTENLIQQRIGFP*(+) MGLSIGTMIAGWDEKGPGLYYVDSEGARLMGSRFSVGSGSLYAYGILDEGADSMSSRTSGGSLL LVLQSFWPTSCTPTVGWDCQLVQ*(-) MRRVLACTMLIVRAQGSWEADSLLDQVLCMPMVSWTRVPTP*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |