Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0153800_circ_g.3 |
| ID in PlantcircBase | osa_circ_029723 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 2772160-2772487 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os06g0153800 |
| Parent gene annotation |
Beta 5 subunit of 20S proteasome. (Os06t0153800-01) |
| Parent gene strand | - |
| Alternative splicing | Os06g0153800_circ_g.4 |
| Support reads | 1 |
| Tissues | shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0153800-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_006536* osi_circ_016684 |
| PMCS | 0.402683308 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2772418-2772220(+) 2772399-2772375(-) 2772362-2772476(-) |
| Potential amino acid sequence |
MLAKSFEAPAIEILRLFASSWSRHPRPRYHRHTENLIQQRIGFP*(+) MGLSIGTMIAGWDEKGPGLYYVDSEGARLMGSRFSVGSGSLYAYGILDEGADSMSSRTSGGSLL LVLQSFWPTSCTPTVGWDCQLVQ*(-) MRRVLACTMLIVRAQGSWEADSLLDQVLCMPMVSWTRVPTP*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |