Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os06g0153800_circ_g.4 |
ID in PlantcircBase | osa_circ_029724 |
Alias | Os_ciR10558 |
Organism | Oryza sativa |
Position | chr6: 2772353-2772487 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Os06g0153800 |
Parent gene annotation |
Beta 5 subunit of 20S proteasome. (Os06t0153800-01) |
Parent gene strand | - |
Alternative splicing | Os06g0153800_circ_g.3 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os06t0153800-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.671855617 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
2772418-2772404(+) 2772399-2772355(-) 2772362-2772375(-) |
Potential amino acid sequence |
MLAKSFEAPAIEILRLFASSWSRHFSSHPAIIVPIDSPIPR*(+) MGLSIGTMIAGWDEKCRLHELANKRRISIAGASKLLANILYSYRGMGLSIGTMIAGWDEKCRLH ELANKRRISIAGASKLLANILYSYRGMGLSIGTMIAGWDEKCRLHELANKRRISIAGASKLLAN ILYSYRGMGLSIGTMIAGWDEK(-) MRSADSMSSRTSGGSLLLVLQSFWPTSCTPTVGWDCQLVQ*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |