Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0153800_circ_g.4 |
| ID in PlantcircBase | osa_circ_029724 |
| Alias | Os_ciR10558 |
| Organism | Oryza sativa |
| Position | chr6: 2772353-2772487 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os06g0153800 |
| Parent gene annotation |
Beta 5 subunit of 20S proteasome. (Os06t0153800-01) |
| Parent gene strand | - |
| Alternative splicing | Os06g0153800_circ_g.3 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0153800-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.671855617 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2772418-2772404(+) 2772399-2772355(-) 2772362-2772375(-) |
| Potential amino acid sequence |
MLAKSFEAPAIEILRLFASSWSRHFSSHPAIIVPIDSPIPR*(+) MGLSIGTMIAGWDEKCRLHELANKRRISIAGASKLLANILYSYRGMGLSIGTMIAGWDEKCRLH ELANKRRISIAGASKLLANILYSYRGMGLSIGTMIAGWDEKCRLHELANKRRISIAGASKLLAN ILYSYRGMGLSIGTMIAGWDEK(-) MRSADSMSSRTSGGSLLLVLQSFWPTSCTPTVGWDCQLVQ*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |