Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os07g0683900_circ_g.2 |
ID in PlantcircBase | osa_circ_035359 |
Alias | Os_ciR11193 |
Organism | Oryza sativa |
Position | chr7: 29005251-29005373 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Os07g0683900 |
Parent gene annotation |
Ricin B-related lectin domain containing protein. (Os07t0683900- 01);Similar to Osr40g2 protein (Fragment). (Os07t0683900-02) |
Parent gene strand | + |
Alternative splicing | Os07g0683600_circ_ag.1 Os07g0683600_circ_g.1 Os07g0683600_circ_g.2 Os07g0683900_circ_igg.1 Os07g0683600_circ_ig.1 Os07g0683900_circ_g.1 Os07g0683900_circ_ag.1 Os07g0683900_circ_g.3 Os07g0684000_circ_g.1 Os07g0684000_circ_g.2 Os07g0684000_circ_g.3 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os07t0683900-01:1 Os07t0683900-02:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.59202289 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
29005267-29005370(+) 29005269-29005303(-) |
Potential amino acid sequence |
MRHSNKIRDEEGYPAFALVNKVTGEAIKHSTGQGHPHWIKDMRHSNKIRDEEGYPAFALVNKVT GEAIKHSTGQGHPHWIKDMRHSNKIRDEEGYPAFALVNKVTGEAIKHSTGQGHPHWIKDMRHSN KIRDEEGYPAFALVNKVTGEAIKHSTGQGHP(+) MSLIQCGWPCPVECLMASPVTLLTSANAG*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |