Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0683900_circ_g.2 |
| ID in PlantcircBase | osa_circ_035359 |
| Alias | Os_ciR11193 |
| Organism | Oryza sativa |
| Position | chr7: 29005251-29005373 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os07g0683900 |
| Parent gene annotation |
Ricin B-related lectin domain containing protein. (Os07t0683900- 01);Similar to Osr40g2 protein (Fragment). (Os07t0683900-02) |
| Parent gene strand | + |
| Alternative splicing | Os07g0683600_circ_ag.1 Os07g0683600_circ_g.1 Os07g0683600_circ_g.2 Os07g0683900_circ_igg.1 Os07g0683600_circ_ig.1 Os07g0683900_circ_g.1 Os07g0683900_circ_ag.1 Os07g0683900_circ_g.3 Os07g0684000_circ_g.1 Os07g0684000_circ_g.2 Os07g0684000_circ_g.3 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os07t0683900-01:1 Os07t0683900-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.59202289 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
29005267-29005370(+) 29005269-29005303(-) |
| Potential amino acid sequence |
MRHSNKIRDEEGYPAFALVNKVTGEAIKHSTGQGHPHWIKDMRHSNKIRDEEGYPAFALVNKVT GEAIKHSTGQGHPHWIKDMRHSNKIRDEEGYPAFALVNKVTGEAIKHSTGQGHPHWIKDMRHSN KIRDEEGYPAFALVNKVTGEAIKHSTGQGHP(+) MSLIQCGWPCPVECLMASPVTLLTSANAG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |