Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.005G122200_circ_g.1 |
| ID in PlantcircBase | gra_circ_000472 |
| Alias | Chr05:26190477|26190870 |
| Organism | Gossypium raimondii |
| Position | chrChr05: 26190477-26190870 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.005G122200 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 5/27 |
| Tissues | leaf/ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.005G122200.2:2 Gorai.005G122200.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | gar_circ_001030* ghi_circ_000025* |
| PMCS | 0.664881303 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
26190861-26190538(+) 26190725-26190500(+) 26190494-26190818(-) |
| Potential amino acid sequence |
MGWGGLQTHWILTRTMMPVFSRQP*(+) MIFQGTTFSSKKLEILQIDYYLLGILLLGSLIMLSTWLVEMHITLDGLGWVANSLDFNKDYDAS VFETTIRVVGGLLSAYDLSRDNVFLEKARDIADRLLPAWDTTTGIPYNVINLARGNAHNPGWAG VGCKLIGF*(+) MSLQPTPAHPGLCAFPRAKLITL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |