Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0301600_circ_g.9 |
| ID in PlantcircBase | osa_circ_027315 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 13539322-13539702 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os05g0301600 |
| Parent gene annotation |
Protein phosphatase inhibitor 2 (IPP-2) family protein. (Os05t03 01600-01) |
| Parent gene strand | + |
| Alternative splicing | Os05g0301600_circ_g.2 Os05g0301600_circ_g.3 Os05g0301600_circ_g.4 Os05g0301600_circ_g.5 Os05g0301600_circ_g.6 Os05g0301600_circ_g.7 Os05g0301600_circ_g.8 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os05t0301600-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.508285783 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
13539423-13539332(+) 13539614-13539342(+) |
| Potential amino acid sequence |
MVDDDGSLSPTRPFDKCLDETVNAEAILTALNGVASSSKTDPKDDGWASSDDDADAMEQDDALV V*(+) MVWLLQAKLIQRMMVGHPQMMMQMPWNKMMLSSCEVE*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |