Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0301600_circ_g.3 |
| ID in PlantcircBase | osa_circ_027309 |
| Alias | Os_ciR1576 |
| Organism | Oryza sativa |
| Position | chr5: 13538273-13539702 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, find_circ |
| Parent gene | Os05g0301600 |
| Parent gene annotation |
Protein phosphatase inhibitor 2 (IPP-2) family protein. (Os05t03 01600-01) |
| Parent gene strand | + |
| Alternative splicing | Os05g0301600_circ_g.2 Os05g0301600_circ_g.4 Os05g0301600_circ_g.5 Os05g0301600_circ_g.6 Os05g0301600_circ_g.7 Os05g0301600_circ_g.8 Os05g0301600_circ_g.9 |
| Support reads | 10/2 |
| Tissues | root/shoot, root, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os05t0301600-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_006122* osi_circ_015281 |
| PMCS | 0.353565163 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
13538341-13538334(+) 13539614-13538278(+) 13538305-13539417(-) |
| Potential amino acid sequence |
MSSRRVKWNEDNLYEIESNKPVRQKITEPKTPYHPMVDDDGSLSPTRPFDKCLDETVNAEAILT ALNGVASSSKTDPKDDGWASSDDDADAMEQDDAFVSEDFSNFIYFPSLGGVEA*(+) MVWLLQAKLIQRMMVGHPQMMMQMPWNKMMLS*(+) MKFEKSSLTKASSCSMASASSSEDAQPSSFGSVLLEEATPFKAVKIASALTVSSRHLSKGRVGD NDPSSSTIG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |