Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os05g0301600_circ_g.3 |
ID in PlantcircBase | osa_circ_027309 |
Alias | Os_ciR1576 |
Organism | Oryza sativa |
Position | chr5: 13538273-13539702 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, find_circ |
Parent gene | Os05g0301600 |
Parent gene annotation |
Protein phosphatase inhibitor 2 (IPP-2) family protein. (Os05t03 01600-01) |
Parent gene strand | + |
Alternative splicing | Os05g0301600_circ_g.2 Os05g0301600_circ_g.4 Os05g0301600_circ_g.5 Os05g0301600_circ_g.6 Os05g0301600_circ_g.7 Os05g0301600_circ_g.8 Os05g0301600_circ_g.9 |
Support reads | 10/2 |
Tissues | root/shoot, root, seed |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os05t0301600-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_006122* osi_circ_015281 |
PMCS | 0.353565163 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
13538341-13538334(+) 13539614-13538278(+) 13538305-13539417(-) |
Potential amino acid sequence |
MSSRRVKWNEDNLYEIESNKPVRQKITEPKTPYHPMVDDDGSLSPTRPFDKCLDETVNAEAILT ALNGVASSSKTDPKDDGWASSDDDADAMEQDDAFVSEDFSNFIYFPSLGGVEA*(+) MVWLLQAKLIQRMMVGHPQMMMQMPWNKMMLS*(+) MKFEKSSLTKASSCSMASASSSEDAQPSSFGSVLLEEATPFKAVKIASALTVSSRHLSKGRVGD NDPSSSTIG*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |