Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G30580_circ_g.7 |
| ID in PlantcircBase | ath_circ_005087 |
| Alias | At_ciR1532, AT1G30580_C1 |
| Organism | Arabidpsis thaliana |
| Position | chr1: 10832906-10833429 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, find_circ, CIRI-full, CIRI2 |
| Parent gene | AT1G30580 |
| Parent gene annotation |
Obg-like ATPase 1 |
| Parent gene strand | - |
| Alternative splicing | AT1G30580_circ_g.1 AT1G30580_circ_g.2 AT1G30580_circ_g.3 AT1G30580_circ_g.4 AT1G30580_circ_g.5 AT1G30580_circ_g.6 AT1G30580_circ_g.8 AT1G30580_circ_g.9 AT1G30580_circ_g.10 AT1G30580_circ_g.11 AT1G30580_circ_g.12 AT1G30580_circ_g.13 AT1G30580_circ_g.14 AT1G30580_circ_g.15 AT1G30580_circ_g.16 AT1G30580_circ_g.17 AT1G30580_circ_g.18 AT1G30580_circ_g.19 |
| Support reads | 8/2 |
| Tissues | leaf/aerial, inflorescences, whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT1G30580.1:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.277603365 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
10833181-10832908(-) |
| Potential amino acid sequence |
MIPFSGVFERSLADMAPDEAAKYCEENKLQSALPRIIKTGFSAINLIYFFTAGPDEINLNERDY QRKKNKFLPKIHAWVQEHGGDTMIPFSGVFERSLADMAPDEAAKYCEENKLQSALPRIIKTGFS AINLIYFFTAGPDEINLNERDYQRKKNKFLPKIHAWVQEHGGDTMIPFSGVFERSLADMAPDEA AKYCEENKLQSALPRIIKTGFSAINLIYFFTAGPDEINLNERDYQRKKNKFLPKIHAWVQEHGG DTMIPFSGVFERSLADMAPDEAAKYCEENKLQSALPRIIKTGFSAINLIYFFTAGPDE(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017;Zhang et al., 2019 |