Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G30580_circ_g.13 |
ID in PlantcircBase | ath_circ_005093 |
Alias | At_ciR1516 |
Organism | Arabidpsis thaliana |
Position | chr1: 10833748-10834059 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | find_circ, CIRI-full |
Parent gene | AT1G30580 |
Parent gene annotation |
Obg-like ATPase 1 |
Parent gene strand | - |
Alternative splicing | AT1G30580_circ_g.1 AT1G30580_circ_g.2 AT1G30580_circ_g.3 AT1G30580_circ_g.4 AT1G30580_circ_g.5 AT1G30580_circ_g.6 AT1G30580_circ_g.7 AT1G30580_circ_g.8 AT1G30580_circ_g.9 AT1G30580_circ_g.10 AT1G30580_circ_g.11 AT1G30580_circ_g.12 AT1G30580_circ_g.14 AT1G30580_circ_g.15 AT1G30580_circ_g.16 AT1G30580_circ_g.17 AT1G30580_circ_g.18 AT1G30580_circ_g.19 |
Support reads | 8 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT1G30580.1:2 |
Conservation Information | |
---|---|
Conserved circRNAs | csi_circ_001147 |
PMCS | 0.350072727 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
10834015-10833750(-) |
Potential amino acid sequence |
MKRSNDKQLKIELELLQKVKAWLEDGKDVRFGDWKTADIEILNTFQLLSAKPVVYLDIEFVGKK IDDVEKSMKRSNDKQLKIELELLQKVKAWLEDGKDVRFGDWKTADIEILNTFQLLSAKPVVYLD IEFVGKKIDDVEKSMKRSNDKQLKIELELLQKVKAWLEDGKDVRFGDWKTADIEILNTFQLLSA KPVVYLDIEFVGKKIDDVEKSMKRSNDKQLKIELELLQKVKAWLEDGKDVRFGDWKTADIEILN TFQLLSAKPVVYL(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |