Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | BGIOSGA013510_circ_g.3 |
| ID in PlantcircBase | osi_circ_005081 |
| Alias | 3:34220472|34220857 |
| Organism | Oryza sativa ssp. indica |
| Position | chr3: 34220472-34220857 JBrowse» |
| Reference genome | Oryza_indica.ASM465v1.42 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | BGIOSGA013510 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | BGIOSGA013510_circ_g.1 BGIOSGA013510_circ_g.2 BGIOSGA013510_circ_g.4 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | BGIOSGA013510-TA:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs |
osa_circ_021656* zma_circ_006918 zma_circ_000876 ecr_circ_000321 osa_circ_008523 |
| PMCS |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
34220506-34220517(+) |
| Potential amino acid sequence |
MQMVVNFFDSVMGFGAATPYTALAQKAMSRHFRCLKDAIAAQLRGTCEALGEKDAGTGSGLTKG ETPRLRAIDQSLRQQRAFHHMGIMEQEAWRPQRGLPERSVNILRSWLFEHFLHPWTGGTTTTAT RCRWW*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | leaf senescence (regulating to parental gene)(validated) |
| Other Information | |
|---|---|
| References | Huang et al., 2021 |