Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | BGIOSGA013510_circ_g.3 |
ID in PlantcircBase | osi_circ_005081 |
Alias | 3:34220472|34220857 |
Organism | Oryza sativa ssp. indica |
Position | chr3: 34220472-34220857 JBrowse» |
Reference genome | Oryza_indica.ASM465v1.42 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | BGIOSGA013510 |
Parent gene annotation | NA |
Parent gene strand | + |
Alternative splicing | BGIOSGA013510_circ_g.1 BGIOSGA013510_circ_g.2 BGIOSGA013510_circ_g.4 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | BGIOSGA013510-TA:1 |
Conservation Information | |
---|---|
Conserved circRNAs |
osa_circ_021656* zma_circ_006918 zma_circ_000876 ecr_circ_000321 osa_circ_008523 |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
34220506-34220517(+) |
Potential amino acid sequence |
MQMVVNFFDSVMGFGAATPYTALAQKAMSRHFRCLKDAIAAQLRGTCEALGEKDAGTGSGLTKG ETPRLRAIDQSLRQQRAFHHMGIMEQEAWRPQRGLPERSVNILRSWLFEHFLHPWTGGTTTTAT RCRWW*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | leaf senescence (regulating to parental gene)(validated) |
Other Information | |
---|---|
References | Huang et al., 2021 |