Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d037808_circ_g.8 |
ID in PlantcircBase | zma_circ_009066 |
Alias | Zm06circ00065, zma_circ_0002238, GRMZM2G424783_C2 |
Organism | Zea mays |
Position | chr6: 138477326-138477964 JBrowse» |
Reference genome | AGPv4.38 |
Type | e-circRNA |
Identification method | CIRI2, find_circ |
Parent gene | Zm00001d037808 |
Parent gene annotation |
protein_coding |
Parent gene strand | - |
Alternative splicing | Zm00001d037808_circ_g.1 Zm00001d037808_circ_g.2 Zm00001d037808_circ_g.3 Zm00001d037808_circ_g.4 Zm00001d037808_circ_g.5 Zm00001d037808_circ_g.6 Zm00001d037808_circ_g.7 Zm00001d037808_circ_g.9 |
Support reads | NA |
Tissues | leaf, endosperm, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d037808_T001:3 Zm00001d037808_T005:3 Zm00001d037808_T006:2 Zm00001d037808_T002:3 Zm00001d037808_T009:3 Zm00001d037808_T003:3 Zm00001d037808_T004:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.25849475 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
138477851-138477360(+) 138477340-138477894(-) 138477964-138477894(-) |
Potential amino acid sequence |
MLPPALTRASTSACLFLSERSRCCLIRVPRKSWGMYVITIIVIYLSNKIQ*(+) MTIMVMTYMPQDFRGTLIRQQRERSERNKQAEVDALVSAGGSIHDRYALLWKQQMERRVQLAQL GSATGVYKTLVRYLVGVPQVLLDFIRQINDDNGYDIHAPRFSGYSNQATARTLREK*(-) MTYMPQDFRGTLIRQQRERSERNKQAEVDALVSAGGSIHDRYALLWKQQMERRVQLAQLGSATG VYKTLVRYLVGVPQVLLDFIRQINDDNGYDIHAPRFSGYSNQATARTLREK*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Han et al., 2020; Ma et al., 2021b;Zhang et al., 2019 |