Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | BGIOSGA010755_circ_g.4 |
ID in PlantcircBase | osi_circ_004808 |
Alias | 3:14404610|14404794 |
Organism | Oryza sativa ssp. indica |
Position | chr3: 14404610-14404794 JBrowse» |
Reference genome | Oryza_indica.ASM465v1.42 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | BGIOSGA010755 |
Parent gene annotation | NA |
Parent gene strand | - |
Alternative splicing | BGIOSGA010755_circ_g.1 BGIOSGA010755_circ_g.2 BGIOSGA010755_circ_g.3 BGIOSGA010755_circ_g.5 BGIOSGA010755_circ_g.6 BGIOSGA010755_circ_igg.1 BGIOSGA010755_circ_igg.2 BGIOSGA010755_circ_g.3 BGIOSGA010755_circ_igg.4 BGIOSGA010755_circ_igg.5 BGIOSGA010755_circ_igg.6 BGIOSGA010755_circ_igg.7 BGIOSGA010755_circ_g.8 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | BGIOSGA010755-TA:1 |
Conservation Information | |
---|---|
Conserved circRNAs | osa_circ_019746* |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
14404787-14404736(-) 14404754-14404613(+) |
Potential amino acid sequence |
MLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVVRRLPRRLMACW VGVKTLENMKQCVK*(-) MFSRVFTPTQHAINRLGSLLTTASSRSNGLLVAASTNTRSLSFVLRPSQFTINSFFILRIASCS PGFSRLPNMPSTA*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Huang et al., 2021 |