Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | BGIOSGA010755_circ_g.4 |
| ID in PlantcircBase | osi_circ_004808 |
| Alias | 3:14404610|14404794 |
| Organism | Oryza sativa ssp. indica |
| Position | chr3: 14404610-14404794 JBrowse» |
| Reference genome | Oryza_indica.ASM465v1.42 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | BGIOSGA010755 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | BGIOSGA010755_circ_g.1 BGIOSGA010755_circ_g.2 BGIOSGA010755_circ_g.3 BGIOSGA010755_circ_g.5 BGIOSGA010755_circ_g.6 BGIOSGA010755_circ_igg.1 BGIOSGA010755_circ_igg.2 BGIOSGA010755_circ_g.3 BGIOSGA010755_circ_igg.4 BGIOSGA010755_circ_igg.5 BGIOSGA010755_circ_igg.6 BGIOSGA010755_circ_igg.7 BGIOSGA010755_circ_g.8 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | BGIOSGA010755-TA:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osa_circ_019746* |
| PMCS |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
14404787-14404736(-) 14404754-14404613(+) |
| Potential amino acid sequence |
MLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVVRRLPRRLMACW VGVKTLENMKQCVK*(-) MFSRVFTPTQHAINRLGSLLTTASSRSNGLLVAASTNTRSLSFVLRPSQFTINSFFILRIASCS PGFSRLPNMPSTA*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Huang et al., 2021 |