Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0344700_circ_g.2 |
| ID in PlantcircBase | osa_circ_019746 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 12838424-12838608 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0344700 |
| Parent gene annotation |
Similar to AAA-type ATPase family protein. (Os03t0344700-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0344700-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_004808* |
| PMCS | 0.959895405 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
12838568-12838427(+) 12838601-12838550(-) |
| Potential amino acid sequence |
MFSRVFTPTQHAINRLGSLLTTASSRSNGLLVAASTNTRSLSFVLRPSQFTINSFFILRIASCS PGFSRLPNMPSTA*(+) MLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVVRRLPRRLMACW VGVKTLENMKQCVK*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |