Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0344700_circ_g.2 |
ID in PlantcircBase | osa_circ_019746 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 12838424-12838608 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os03g0344700 |
Parent gene annotation |
Similar to AAA-type ATPase family protein. (Os03t0344700-01) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os03t0344700-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_004808* |
PMCS | 0.959895405 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
12838568-12838427(+) 12838601-12838550(-) |
Potential amino acid sequence |
MFSRVFTPTQHAINRLGSLLTTASSRSNGLLVAASTNTRSLSFVLRPSQFTINSFFILRIASCS PGFSRLPNMPSTA*(+) MLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVVRRLPRRLMACW VGVKTLENMKQCVK*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |