Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os12g0297500_circ_g.6 |
ID in PlantcircBase | osa_circ_011257 |
Alias | Os12circ05110/Os_ciR1553 |
Organism | Oryza sativa |
Position | chr12: 11734617-11737572 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, SMALT, Segemehl, find_circ |
Parent gene | Os12g0297500 |
Parent gene annotation |
Pyruvate phosphate dikinase, PEP/pyruvate-binding domain contain ing protein. (Os12t0297500-01);Similar to Phosphoglucan, water d ikinase, chloroplastic. (Os12t0297500-02) |
Parent gene strand | - |
Alternative splicing | Os12g0297500_circ_g.4 Os12g0297500_circ_g.5 Os12g0297500_circ_g.7 Os12g0297500_circ_g.8 Os12g0297500_circ_g.9 Os12g0297500_circ_g.10 |
Support reads | 5/12/3 |
Tissues | leaf and panicle/root/shoot, root, seed |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os12t0297500-01:5 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_003411* osi_circ_010444 |
PMCS | 0.328441473 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
11737550-11734667(+) 11737076-11737566(-) |
Potential amino acid sequence |
MDSSCSNRHYFFREYRKKCFRVLFR*(+) MTTLQSLSSLRSVLMKGLESGLRNDAPDNAIAMRQKWRLCEISLEDYSFVLLSRFINTLEALGG SASLAKDVARNTTLWDTTLDALVIGINQVSFSGWKTDECIAIGNEILSWKQKGLSESEGCEDGK YIWSLRLKATLDRARRLTEEYSEALLSIFPEKVMPI*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015;Ye et al., 2015;Chu et al., 2017 |