Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os09g0504700_circ_g.3 |
ID in PlantcircBase | osa_circ_039727 |
Alias | NA |
Organism | Oryza sativa |
Position | chr9: 19503918-19505345 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os09g0504700 |
Parent gene annotation |
Zinc finger, RING/FYVE/PHD-type domain containing protein. (Os09 t0504700-01);Zinc finger, RING/FYVE/PHD-type domain containing p rotein. (Os09t0504700-02);Zinc finger, RING/FYVE/PHD-type domain containing protein. (Os09t0504700-03) |
Parent gene strand | - |
Alternative splicing | Os09g0504700_circ_g.4 Os09g0504700_circ_g.5 Os09g0504700_circ_g.6 Os09g0504700_circ_g.7 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os09t0504700-02:2 Os09t0504700-01:2 Os09t0504700-03:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.117560522 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
19504040-19505342(+) |
Potential amino acid sequence |
MAANCCGGLLQLVPTHRTVKNRFLCLRRLIASLQAGPFSPFWREAVYNRCNPLTFVPLTIRVWK VNTVEIVRPQTLSASRAFLLNLDGLLDACRAEDMAANCCGGLLQLVPTHRTVKNRFLCLRRLIA SLQAGPFSPFWREAVYNRCNPLTFVPLTIRVWKVNTVEIVRPQTLSASRAFLLNLDGLLDACRA EDMAANCCGGLLQLVPTHRTVKNRFLCLRRLIASLQAGPFSPFWREAVYNRCNPLTFVPLTIRV WKVNTVEIVRPQTLSASRAFLLNLDGLLDACRAEDMAANCCGGLLQLVPTHRTVKNRFLCLRRL IASLQAGPFSPFWREAVYNRCNPLTFV(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |