Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0504700_circ_g.7 |
| ID in PlantcircBase | osa_circ_039731 |
| Alias | Os_ciR11875 |
| Organism | Oryza sativa |
| Position | chr9: 19505272-19506128 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | find_circ |
| Parent gene | Os09g0504700 |
| Parent gene annotation |
Zinc finger, RING/FYVE/PHD-type domain containing protein. (Os09 t0504700-01);Zinc finger, RING/FYVE/PHD-type domain containing p rotein. (Os09t0504700-02);Zinc finger, RING/FYVE/PHD-type domain containing protein. (Os09t0504700-03) |
| Parent gene strand | - |
| Alternative splicing | Os09g0504700_circ_g.3 Os09g0504700_circ_g.4 Os09g0504700_circ_g.5 Os09g0504700_circ_g.6 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os09t0504700-02:3 Os09t0504700-01:3 Os09t0504700-03:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_018624 |
| PMCS | 0.119710832 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
19505930-19505332(+) 19506085-19506104(-) |
| Potential amino acid sequence |
MGEARAPVEVGTARRLPTTGEEIASRFTTTLSPGPSCDCLLGARRVPLTVLMLTLELNQWHSTL KSTFKLDPSPLSGERQCITGATL*(+) MSTVSGTRRAPRRQSQDGPGDKVVVNLDAISSPVVGSRRAVPTSTGARASPIDVEALDDEVQTL SASQVPPPRRNRRTRRQPVAVVDLEVDASREGNKRQRVAPVIHCLSPERGEGSSLKVDFRVECH *(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |