Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0355600_circ_g.3 |
| ID in PlantcircBase | osa_circ_019867 |
| Alias | Os_ciR4206 |
| Organism | Oryza sativa |
| Position | chr3: 13588998-13589177 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os03g0355600 |
| Parent gene annotation |
Similar to Adapter-related protein complex 2 beta 1 subunit (Bet a-adaptin) (Plasma membrane adaptor HA2/AP2 adaptin beta subunit ) (Clathrin assembly protein complex 2 beta large chain) (AP105B ) (Fragment). (Os03t0355600-01);Similar to predicted protein. (O s03t0355600-02);Similar to predicted protein. (Os03t0355600-03); Similar to predicted protein. (Os03t0355600-04) |
| Parent gene strand | - |
| Alternative splicing | Os03g0355600_circ_g.1 Os03g0355600_circ_g.2 Os03g0355600_circ_g.4 Os03g0355600_circ_g.5 Os03g0355600_circ_g.6 |
| Support reads | 8 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0355600-01:1 Os03t0355600-03:1 Os03t0355600-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.633901065 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
13589173-13589000(-) |
| Potential amino acid sequence |
MIWIIGEYAERIDNADELLESFLETFPEEPALVQLQLLTATVKLFLKKPTEGPQQMIQASMIWI IGEYAERIDNADELLESFLETFPEEPALVQLQLLTATVKLFLKKPTEGPQQMIQASMIWIIGEY AERIDNADELLESFLETFPEEPALVQLQLLTATVKLFLKKPTEGPQQMIQASMIWIIGEYAERI DNADELLESFLETFPEEPALVQLQLLTATVKLFLKKPTEGPQQMIQ(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |