Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0856500_circ_g.4 |
| ID in PlantcircBase | osa_circ_004868 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 36999956-37000637 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0856500 |
| Parent gene annotation |
Auxin transporter, Primary root and root hair elongation, Cd str ess response (Os01t0856500-01);Amino acid transporter, transmemb rane domain containing protein. (Os01t0856500-02);Splicing varia nt with unknown function (Os01t0856500-03);Similar to auxin tran sporter-like protein 1. (Os01t0856500-04) |
| Parent gene strand | + |
| Alternative splicing | Os01g0856500_circ_g.2 Os01g0856500_circ_g.3 Os01g0856500_circ_g.5 Os01g0856500_circ_g.6 |
| Support reads | 5 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0856500-01:3 Os01t0856500-03:2 Os01t0856500-04:2 Os01t0856500-02:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | zma_circ_007738 zma_circ_001456 |
| PMCS | 0.291196347 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
37000376-37000052(+) 37000252-37000633(-) |
| Potential amino acid sequence |
MTTYTAWYLAIAALLNGQAEGITHTGPTKLVLYFTGATNILYTFGGHAVTVGSRCWMGYWARTG RRPDSPSTARSSSSAPSSS*(+) MLLAQAISWMTEPKRRNVQLKASPAAFQYGPSSPSSTSNQL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |