Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os07g0113700_circ_g.3 |
ID in PlantcircBase | osa_circ_032632 |
Alias | Os_ciR11310 |
Organism | Oryza sativa |
Position | chr7: 755742-757242 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os07g0113700 |
Parent gene annotation |
Tetratricopeptide-like helical domain containing protein. (Os07t 0113700-01) |
Parent gene strand | - |
Alternative splicing | Os07g0113700_circ_g.1 Os07g0113700_circ_g.2 Os07g0113700_circ_g.4 Os07g0113700_circ_g.5 Os07g0113700_circ_g.6 Os07g0113700_circ_g.7 |
Support reads | 2/1 |
Tissues | root/shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os07t0113700-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.165281762 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
756246-757166(-) |
Potential amino acid sequence |
MAGLAAIEIAQKVSKAWRFLRNPKNNAKLVRRRDKLNACQNRGGYCSTSTLSGSPTSSPNEDRI SSGISLSWHDVYNIAVKWRQISEPCDPVVWINKLSEEFNSGFGSHTPMLLGQAKIIRYYPYYQR NIGANDCILKMWLKRSIGNHRYGSH*(-) |
Sponge-miRNAs | osa-miR319a-3p.2-3p |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |