Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0113700_circ_g.3 |
| ID in PlantcircBase | osa_circ_032632 |
| Alias | Os_ciR11310 |
| Organism | Oryza sativa |
| Position | chr7: 755742-757242 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os07g0113700 |
| Parent gene annotation |
Tetratricopeptide-like helical domain containing protein. (Os07t 0113700-01) |
| Parent gene strand | - |
| Alternative splicing | Os07g0113700_circ_g.1 Os07g0113700_circ_g.2 Os07g0113700_circ_g.4 Os07g0113700_circ_g.5 Os07g0113700_circ_g.6 Os07g0113700_circ_g.7 |
| Support reads | 2/1 |
| Tissues | root/shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os07t0113700-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.165281762 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
756246-757166(-) |
| Potential amino acid sequence |
MAGLAAIEIAQKVSKAWRFLRNPKNNAKLVRRRDKLNACQNRGGYCSTSTLSGSPTSSPNEDRI SSGISLSWHDVYNIAVKWRQISEPCDPVVWINKLSEEFNSGFGSHTPMLLGQAKIIRYYPYYQR NIGANDCILKMWLKRSIGNHRYGSH*(-) |
| Sponge-miRNAs | osa-miR319a-3p.2-3p |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |