Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d020036_circ_g.4 |
ID in PlantcircBase | zma_circ_009309 |
Alias | zma_circ_0002768 |
Organism | Zea mays |
Position | chr7: 87390220-87391162 JBrowse» |
Reference genome | AGPv4.38 |
Type | ue-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d020036 |
Parent gene annotation |
Embryonic flower 2; VEF family protein |
Parent gene strand | + |
Alternative splicing | Zm00001d020036_circ_g.1 Zm00001d020036_circ_g.2 Zm00001d020036_circ_g.3 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d020036_T003:4 Zm00001d020036_T012:3 Zm00001d020036_T002:4 Zm00001d020036_T011:2 Zm00001d020036_T009:3 Zm00001d020036_T007:3 Zm00001d020036_T001:3 Zm00001d020036_T004:3 Zm00001d020036_T013:3 Zm00001d020036_T008:3 Zm00001d020036_T005:3 Zm00001d020036_T006:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.154523815 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
87390337-87390223(+) |
Potential amino acid sequence |
MRPSFLEPKFLEQDSCLTFCSHKVDAVVRYASLATASPLDDMSLHHKFINSALGIHCHRMRYIH FSMELLENDFSFQFKCPKLLAKGSYKLQLCMSAQEAGARDMSLSPYSSYSYNDVPPSSLSDIIS A*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |