Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0279100_circ_g.1 |
ID in PlantcircBase | osa_circ_001321 |
Alias | Os01circ08810 |
Organism | Oryza sativa |
Position | chr1: 9875250-9875778 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, SMALT, Segemehl |
Parent gene | Os01g0279100 |
Parent gene annotation |
Subunit of magnesium-protoporphyrin IX monomethyl ester cyclase (EC:1.14.13.81), Core component of FLU-YGL8-LCAA-POR complex, Ch lorophyll biosynthesis, Chloroplast development (Os01t0279100-01 );Similar to Magnesium-protoporphyrin ix monomethyl ester cyclas e (Fragment). (Os01t0279100-02) |
Parent gene strand | + |
Alternative splicing | Os01g0279100_circ_g.2 Os01g0279100_circ_g.3 Os01g0279100_circ_g.4 Os01g0279100_circ_g.5 |
Support reads | 2/2 |
Tissues | leaf and panicle/shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0279100-01:2 Os01t0279100-02:1 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_001977* osi_circ_008938 |
PMCS | 0.613686878 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
9875693-9875270(+) 9875347-9875700(-) |
Potential amino acid sequence |
MYLNDCQRTTFYEGIGLDTKEFDMHVIIEVLEQGAV*(+) MNLGLKKVYFLALVKNPRSSAKLKSDSPLFKNLNYHMHVEFFGVQTNPFIECSTLAII*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015;Chu et al., 2017 |