Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0279100_circ_g.1 |
| ID in PlantcircBase | osa_circ_001321 |
| Alias | Os01circ08810 |
| Organism | Oryza sativa |
| Position | chr1: 9875250-9875778 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, SMALT, Segemehl |
| Parent gene | Os01g0279100 |
| Parent gene annotation |
Subunit of magnesium-protoporphyrin IX monomethyl ester cyclase (EC:1.14.13.81), Core component of FLU-YGL8-LCAA-POR complex, Ch lorophyll biosynthesis, Chloroplast development (Os01t0279100-01 );Similar to Magnesium-protoporphyrin ix monomethyl ester cyclas e (Fragment). (Os01t0279100-02) |
| Parent gene strand | + |
| Alternative splicing | Os01g0279100_circ_g.2 Os01g0279100_circ_g.3 Os01g0279100_circ_g.4 Os01g0279100_circ_g.5 |
| Support reads | 2/2 |
| Tissues | leaf and panicle/shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0279100-01:2 Os01t0279100-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_001977* osi_circ_008938 |
| PMCS | 0.613686878 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
9875693-9875270(+) 9875347-9875700(-) |
| Potential amino acid sequence |
MYLNDCQRTTFYEGIGLDTKEFDMHVIIEVLEQGAV*(+) MNLGLKKVYFLALVKNPRSSAKLKSDSPLFKNLNYHMHVEFFGVQTNPFIECSTLAII*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Chu et al., 2017 |