Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | BGIOSGA003260_circ_g.2 |
ID in PlantcircBase | osi_circ_001977 |
Alias | 1:10819416|10819946 |
Organism | Oryza sativa ssp. indica |
Position | chr1: 10819416-10819946 JBrowse» |
Reference genome | Oryza_indica.ASM465v1.42 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | BGIOSGA003260 |
Parent gene annotation | NA |
Parent gene strand | + |
Alternative splicing | BGIOSGA003260_circ_g.1 BGIOSGA003260_circ_g.3 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | BGIOSGA003260-TA:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osa_circ_001321* |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
10819514-10819887(-) 10819861-10819436(+) |
Potential amino acid sequence |
MNLWLEEGVLPSLGQEPEVQCQVEIRQPLVQEPQLSHACRILWCPDQSLHRM*(-) MYLNDCQRTTFYEGIGLDTKEFDMHVIIEVLEQGAV*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Huang et al., 2021 |