Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0719100_circ_g.7 |
ID in PlantcircBase | osa_circ_021319 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 29130020-29131546 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os03g0719100 |
Parent gene annotation |
SUMO (small ubiquitin-related modifier) E3-ligase, Abiotic stres s response, Stress adaptation (Os03t0719100-01) |
Parent gene strand | + |
Alternative splicing | Os03g0719100_circ_g.1 Os03g0719100_circ_g.2 Os03g0719100_circ_g.3 Os03g0719100_circ_g.4 Os03g0719100_circ_g.5 Os03g0719100_circ_g.6 Os03g0719100_circ_g.8 Os03g0719100_circ_g.9 Os03g0719100_circ_g.10 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os03t0719100-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.110439969 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
29130329-29130034(+) 29131525-29130034(+) 29130043-29131493(-) |
Potential amino acid sequence |
MLQKDEYDLQVWCILFNDSVPFRMQWPLHSDIQINGIPIRVVNRQPTQQLGVNGRDDGPVFLGY C*(+) MVETMVQFFWVTVNHPVLPVSITPCKVASDGSYAVQYFEKTFPLSRANWEMLQKDEYDLQVWCI LFNDSVPFRMQWPLHSDIQINGIPIRVVNRQPTQQLGVNGRDDGPVFLGYC*(+) MINSNPEKLDHRLYHSPLTVVWVAC*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |